PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 304aa    MW: 33976.3 Da    PI: 8.3042
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089804.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-19137191256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_011089804.1 137 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRPRQVEVWFQNRRARTK 191
                     678899***********************************************98 PP

2HD-ZIP_I/II128.23.5e-41137226191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+++LEe+F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr +l
  XP_011089804.1 137 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTEENRRLQKEVTELR-AL 226
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.8E-271114IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.346133193IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-18134196IPR009057Homeodomain-like
SMARTSM003896.5E-16135197IPR001356Homeobox domain
SuperFamilySSF466894.71E-19135202IPR009057Homeodomain-like
PfamPF000461.2E-16137191IPR001356Homeobox domain
CDDcd000862.06E-15137194No hitNo description
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
SMARTSM003406.7E-26193236IPR003106Leucine zipper, homeobox-associated
PfamPF021838.9E-11193227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAEKDDGLGL SLSLRCPESQ KHNPPPHPPP PPPAAAAPFP LNLFRSPLPF MQHHKSSTSD  60
AFQSSADHNA EARSIFRGID VNRAITVIDC DEEVMVSSPN STVSSLSGKR SEREENDGER  120
ASSSLEMEDD GGDASGRKKL RLSKEQAAVL EETFKEHNTL NPKQKMALAK QLNLRPRQVE  180
VWFQNRRART KLKQTEVDCE YLRRCCENLT EENRRLQKEV TELRALKLSP QFYMNMSPPT  240
TLTMCPQCER VAVSSSANTS SPIPANTTGI NRQPAHHQRA MPMSSWAAII PPQPQPLDAH  300
RPRT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185193RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466021e-92HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-133A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.18e-91homeobox protein 2